Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.23
PubTator Score 1.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.700 7.4e-06
ependymoma -1.400 5.0e-02
glioblastoma -1.100 2.9e-02
group 3 medulloblastoma 1.200 2.0e-03
hepatocellular carcinoma 1.200 6.6e-05
intraductal papillary-mucinous adenoma (... 1.300 2.3e-03
intraductal papillary-mucinous carcinoma... 1.200 2.9e-03
intraductal papillary-mucinous neoplasm ... 1.400 7.8e-03
medulloblastoma, large-cell -1.200 2.5e-02
osteosarcoma 2.547 1.9e-04
ovarian cancer 1.200 4.3e-04
pancreatic cancer 1.100 2.8e-03
pancreatic carcinoma 1.100 2.8e-03
Pick disease -1.300 3.3e-03
progressive supranuclear palsy -1.200 9.2e-03
psoriasis -1.300 6.7e-04
Rheumatoid arthritis 1.100 4.0e-02
subependymal giant cell astrocytoma -1.299 4.1e-02
tuberculosis -1.300 3.9e-03

Gene RIF (2)

AA Sequence

MSKKPPNRPGITFEIGARLEALDYLQKWYPSRIEKIDYEEGKMLVHFERWSHRYDEWIYWDSNRLRPLER      1 - 70
PALRKEGLKDEEDFFDFKAGEEVLARWTDCRYYPAKIEAINKEGTFTVQFYDGVIRCLKRMHIKAMPEDA     71 - 140
KGQVKSQHPLSWCCPIDPAGSCNQSMGSEDWIALVKAAAAAAAKNKTGSKPRTSANSNKDKDKDERKWFK    141 - 210
VPSKKEETSTCIATPDVEKKEDLPTSSETFGLHVENVPKMVFPQPESTLSNKRKNNQGNSFQAKRARLNK    211 - 280
ITGLLASKAVGVDGAEKKEDYNETAPMLEQAISPKPQSQKKNEADISSSANTQKPALLSSTLSSGKARSK    281 - 350
KCKHESGDSSGCIKPPKSPLSPELIQVEDLTLVSQLSSSVINKTSPPQPVNPPRPFKHSERRRRSQRLAT    351 - 420
LPMPDDSVEKVSSPSPATDGKVFSISSQNQQESSVPEVPDVAHLPLEKLGPCLPLDLSRGSEVTAPVASD    421 - 490
SSYRNECPRAEKEDTQMLPNPSSKAIADGRGAPAAAGISKTEKKVKLEDKSSTAFGKRKEKDKERREKRD    491 - 560
KDHYRPKQKKKKKKKKKSKQHDYSDYEDSSLEFLERCSSPLTRSSGSSLASRSMFTEKTTTYQYPRAILS    561 - 630
VDLSGENLSDVDFLDDSSTESLLLSGDEYNQDFDSTNFEESQDEDDALNEIVRCICEMDEENGFMIQCEE    631 - 700
CLCWQHSVCMGLLEESIPEQYICYICRDPPGQRWSAKYRYDKEWLNNGRMCGLSFFKENYSHLNAKKIVS    701 - 770
THHLLADVYGVTEVLHGLQLKIGILKNKHHPDLHLWACSGKRKDQDQIIAGVEKKIAQDTVNREEKKYVQ    771 - 840
NHKEPPRLPLKMEGTYITSEHSYQKPQSFGQDCKSLADPGSSDDDDVSSLEEEQEFHMRSKNSLQYSAKE    841 - 910
HGMPEKNPAEGNTVFVYNDKKGTEDPGDSHLQWQLNLLTHIENVQNEVTSRMDLIEKEVDVLESWLDFTG    911 - 980
ELEPPDPLARLPQLKRHIKQLLIDMGKVQQIATLCSV                                     981 - 1017
//

Text Mined References (12)

PMID Year Title