Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.29
PubTator Score 1.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 6.71808532819276E-8
atypical teratoid / rhabdoid tumor 4369 7.37812392937622E-6
ovarian cancer 8492 1.37982320682649E-5
tuberculosis and treatment for 6 months 686 4.34734011455982E-5
hepatocellular carcinoma 550 6.56150309035457E-5
osteosarcoma 7933 1.89064059125285E-4
psoriasis 6685 6.6574673948127E-4
group 3 medulloblastoma 2254 0.00199267898867702
medulloblastoma, large-cell 6234 0.00252043149964891
pancreatic cancer 2300 0.00281197257712035
pancreatic carcinoma 567 0.00281197257712038
Pick disease 1893 0.00328042645787081
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0078203166900171
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00885251779380428
progressive supranuclear palsy 674 0.00916094515077942
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0188710985724674
glioblastoma 5572 0.0294566730734777
Rheumatoid Arthritis 1171 0.0402323403041324
subependymal giant cell astrocytoma 2287 0.0413332292452133
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

Synonym

Accession A8MW92 A8MZC9 Q86U89 Q86W43 Q96BT0 Q9H702 Q9HBK3 Q9NYR3 Q9Y381
Symbols URLC1
CGI-72
TDRD20B

Gene

PDB

2EQM   2EQU   2JTF  

  Ortholog (7)

Species Source
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Pig OMA Inparanoid
Opossum OMA EggNOG
Opossum OMA Inparanoid
Platypus EggNOG Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (2)

PMID Text
26588862 results demonstrated the oncogenic potential of PHF20L1 and its association with poor prognostic parameters in breast cancer.
24492612 Malignant brain tumor domain of PHF20L1 reads and controls enzyme levels of methylated DNMT1 in cells, thus representing a novel antagonist of DNMT1 degradation.

AA Sequence

MSKKPPNRPGITFEIGARLEALDYLQKWYPSRIEKIDYEEGKMLVHFERWSHRYDEWIYWDSNRLRPLER      1 - 70
PALRKEGLKDEEDFFDFKAGEEVLARWTDCRYYPAKIEAINKEGTFTVQFYDGVIRCLKRMHIKAMPEDA     71 - 140
KGQVKSQHPLSWCCPIDPAGSCNQSMGSEDWIALVKAAAAAAAKNKTGSKPRTSANSNKDKDKDERKWFK    141 - 210
VPSKKEETSTCIATPDVEKKEDLPTSSETFGLHVENVPKMVFPQPESTLSNKRKNNQGNSFQAKRARLNK    211 - 280
ITGLLASKAVGVDGAEKKEDYNETAPMLEQAISPKPQSQKKNEADISSSANTQKPALLSSTLSSGKARSK    281 - 350
KCKHESGDSSGCIKPPKSPLSPELIQVEDLTLVSQLSSSVINKTSPPQPVNPPRPFKHSERRRRSQRLAT    351 - 420
LPMPDDSVEKVSSPSPATDGKVFSISSQNQQESSVPEVPDVAHLPLEKLGPCLPLDLSRGSEVTAPVASD    421 - 490
SSYRNECPRAEKEDTQMLPNPSSKAIADGRGAPAAAGISKTEKKVKLEDKSSTAFGKRKEKDKERREKRD    491 - 560
KDHYRPKQKKKKKKKKKSKQHDYSDYEDSSLEFLERCSSPLTRSSGSSLASRSMFTEKTTTYQYPRAILS    561 - 630
VDLSGENLSDVDFLDDSSTESLLLSGDEYNQDFDSTNFEESQDEDDALNEIVRCICEMDEENGFMIQCEE    631 - 700
CLCWQHSVCMGLLEESIPEQYICYICRDPPGQRWSAKYRYDKEWLNNGRMCGLSFFKENYSHLNAKKIVS    701 - 770
THHLLADVYGVTEVLHGLQLKIGILKNKHHPDLHLWACSGKRKDQDQIIAGVEKKIAQDTVNREEKKYVQ    771 - 840
NHKEPPRLPLKMEGTYITSEHSYQKPQSFGQDCKSLADPGSSDDDDVSSLEEEQEFHMRSKNSLQYSAKE    841 - 910
HGMPEKNPAEGNTVFVYNDKKGTEDPGDSHLQWQLNLLTHIENVQNEVTSRMDLIEKEVDVLESWLDFTG    911 - 980
ELEPPDPLARLPQLKRHIKQLLIDMGKVQQIATLCSV                                     981 - 1017
//

Text Mined References (11)

PMID Year Title
26588862 2016 An integrated genomic analysis of Tudor domain-containing proteins identifies PHD finger protein 20-like 1 (PHF20L1) as a candidate oncogene in breast cancer.
24492612 2014 Methyllysine reader plant homeodomain (PHD) finger protein 20-like 1 (PHF20L1) antagonizes DNA (cytosine-5) methyltransferase 1 (DNMT1) proteasomal degradation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16415788 2006 Tudor, MBT and chromo domains gauge the degree of lysine methylation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...