Knowledge Summary

Patent

No data available

Synonym

Accession A8MV72
Symbols

Gene

 Compartment GO Term (1)

AA Sequence

MLSARNSMMFGHLSPVRIPRLRGKFNLQLPSLDEQVIPARLLKMEVRAEEPKEATEVKDQVETQGQEDNK      1 - 70
MGPCSNGEAASTSRPLETQGNLTSSWYNPRPLEGNVHLKSLTEKNQTDKAQVHAVSFYSKGHGVASSHSP     71 - 140
AGGILPFGKPDPLPTVLPAPVPGCSLWPEKAALKVLGKDHLPSSPGLLMVGEDMQPKDPAVLGSSRSSPP    141 - 210
RAAGHRSRKRKLSGPPLQLQLTPPLQLRWDRDGGPPPAKLPCLSPEALLVGQASQREGRLQQGNMRKNMR    211 - 280
VLSRTSKFRRRKQLLRRRKKTRQGRRGGSCL                                           281 - 311
//

Text Mined References (1)

PMID Year Title
16421571 2006 DNA sequence and analysis of human chromosome 8.