Property Summary

NCBI Gene PubMed Count 13
PubMed Score 7.95
PubTator Score 8.65

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

PMID Text
23415753 VGLL3 is involved in tumor suppressor pathways, a feature that is characterized by the absence of VGLL3 expression in high-grade serous ovarian carcinomas samples.
23152581 vestigial-like 3 (Vgll3) is an inhibitor of adipogenesis
20842732 data suggest that the amplification and overexpression of YAP1 and VGLL3 could be involved in oncogenesis and progression of soft tissue sarcomas
12376544 This protein was named Vestigial-like 3, because it is related to the Drosophila protein Vestigial. Like other members of this family, it contains a consensus TEF-1 and MEF2(TDU)interaction domain.

AA Sequence

MSCAEVMYHPQPYGASQYLPNPMAATTCPTAYYQPAPQPGQQKKLAVFSKMQDSLEVTLPSKQEEEDEEE      1 - 70
EEEEKDQPAEMEYLNSRCVLFTYFQGDIGSVVDEHFSRALGQAITLHPESAISKSKMGLTPLWRDSSALS     71 - 140
SQRNSFPTSFWTSSYQPPPAPCLGGVHPDFQVTGPPGTFSAADPSPWPGHNLHQTGPAPPPAVSESWPYP    141 - 210
LTSQVSPSYSHMHDVYMRHHHPHAHMHHRHRHHHHHHHPPAGSALDPSYGPLLMPSVHAARIPAPQCDIT    211 - 280
KTEPTTVTSATSAWAGAFHGTVDIVPSVGFDTGLQHQDKSKESPWY                            281 - 326
//

Text Mined References (15)

PMID Year Title
23449627 2013 Genome-wide association and longitudinal analyses reveal genetic loci linking pubertal height growth, pubertal timing and childhood adiposity.
23415753 2013 VGLL3 expression is associated with a tumor suppressor phenotype in epithelial ovarian cancer.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23152581 2013 Vestigial-like 3 is an inhibitor of adipocyte differentiation.
22219177 2012 A genome-wide search for loci interacting with known prostate cancer risk-associated genetic variants.
21102462 2010 Thirty new loci for age at menarche identified by a meta-analysis of genome-wide association studies.
20842732 2010 YAP1 and VGLL3, encoding two cofactors of TEAD transcription factors, are amplified and overexpressed in a subset of soft tissue sarcomas.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...