Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession A8MV57
Symbols MPTX

Gene

 Compartment GO Term (0)

AA Sequence

MGMYLLHIGNAAVTFNGPTPCPRSPYASTHVNVSWESASGIATLWANGKLVGRKGVWKGYSVGEEAKIIL      1 - 70
GQEQDSFGGHFDENQSFVGVIWDVFLWDHVLPPKEMCDSCYSGSLLNRHTLTYEDNGYVVTKPKVWA        71 - 137
//

Text Mined References (3)

PMID Year Title
18850182 2007 Dietary modulation and structure prediction of rat mucosal pentraxin (Mptx) protein and loss of function in humans.
17903293 2007 Genome-wide association with select biomarker traits in the Framingham Heart Study.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.