Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession A8MV57
Symbols MPTX

Gene

 GO Function (1)

 Compartment GO Term (0)

AA Sequence

MGMYLLHIGNAAVTFNGPTPCPRSPYASTHVNVSWESASGIATLWANGKLVGRKGVWKGYSVGEEAKIIL      1 - 70
GQEQDSFGGHFDENQSFVGVIWDVFLWDHVLPPKEMCDSCYSGSLLNRHTLTYEDNGYVVTKPKVWA        71 - 137
//

Text Mined References (3)

PMID Year Title