Property Summary

NCBI Gene PubMed Count 1
Grant Count 55
R01 Count 33
Funding $4,766,746.95
PubMed Score 125.48

Knowledge Summary

Patent

No data available

AA Sequence

MGAMAKPDCIITCDSKNLTIKTESTLKTTQFSGTLGEKFEENTADGRRTQTVCNFTDGALVQHQEWDGKE      1 - 70
STITRKLKDGKLVVERVMNHVACTRIYEKAQ                                            71 - 101
//

Text Mined References (1)

PMID Year Title
12853948 2003 The DNA sequence of human chromosome 7.