Property Summary

NCBI Gene PubMed Count 1
PubMed Score 141.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 8.8e-28
lung adenocarcinoma 2716 1.2e-05
Breast cancer 3578 1.7e-04
Disease Target Count Z-score Confidence
Globe disease 67 0.0 3.0
Disease Target Count Z-score Confidence
Irritant dermatitis 9 3.483 1.7
Cancer 2499 3.227 1.6

Synonym

Accession A8MUU1
Symbols FABP5L3

Gene

AA Sequence

MGAMAKPDCIITCDSKNLTIKTESTLKTTQFSGTLGEKFEENTADGRRTQTVCNFTDGALVQHQEWDGKE      1 - 70
STITRKLKDGKLVVERVMNHVACTRIYEKAQ                                            71 - 101
//

Text Mined References (1)

PMID Year Title