Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00
PubTator Score 18.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
diabetes mellitus 1,663

Synonym

Accession A8MUM7 C5HZ26
Symbols

Gene

PANTHER Protein Class (1)

 GO Function (1)

 Compartment GO Term (0)

AA Sequence

MSFLTVPYKLPVSLSVGSCVIIKGTLIDSSINEPQLQVDFYTEMNEDSEIAFHLRVHLGRRVVMNSREFG      1 - 70
IWMLEENLHYVPFEDGKPFDLRIYVCLNEYEVKVNGEYIYAFVHRIPPSYVKMIQVWRDVSLDSVLVNNG     71 - 140
RR                                                                        141 - 142
//

Text Mined References (2)

PMID Year Title
19497882 2009 A primate subfamily of galectins expressed at the maternal-fetal interface that promote immune cell death.
15057824 2004 The DNA sequence and biology of human chromosome 19.