Property Summary

NCBI Gene PubMed Count 1
PubMed Score 1.76
PubTator Score 18.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1728 1.0e-03
Disease Target Count Z-score Confidence
Severe pre-eclampsia 3 3.652 1.8

AA Sequence

MSFLTVPYKLPVSLSVGSCVIIKGTLIDSSINEPQLQVDFYTEMNEDSEIAFHLRVHLGRRVVMNSREFG      1 - 70
IWMLEENLHYVPFEDGKPFDLRIYVCLNEYEVKVNGEYIYAFVHRIPPSYVKMIQVWRDVSLDSVLVNNG     71 - 140
RR                                                                        141 - 142
//

Text Mined References (2)

PMID Year Title