Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession A8MUH7
Symbols PDZK1P2
OTTHUMT00000038524

Gene

 Compartment GO Term (0)

AA Sequence

MNGGVQTWTQPRLCYLVKEGGSHGFSLKTVQGKKGVYMTDITPQGVAMRAGVLADDHLIEVNGENVEDAS      1 - 70
HEEVVEKVKKSGSRVMFLLVDKETDKRHVEQKIQFKRETASLKLLPHQPRIVEMKKGSNGYGFYLRAGSE     71 - 140
QKGWGRVGQIIKDIDSGSPAEEAGLKNNDLVVAVNGESVETLDHDSVVEMIRKGGDQTSLLVVDKETDNM    141 - 210
YRLAHFSPFLYYQSQELPNGSVKEAPAPTPTSLEVSSPPDTTEEEDHKPKLCRLAKGENGYGFHLNAIRG    211 - 280
LPGSFIKEVQKGGPADLAGLEDEDVIIEVNGVNVLDEPYEKVVDRIQSSGKNVTLLVCGKKAYDYFQAKK    281 - 350
IPIVSSLADPLDTPPDSKEGIVVESKHDSHMAKERAHSTASHSSSNSEDTEM                      351 - 402
//

Text Mined References (3)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.