Knowledge Summary

Patent

No data available

Synonym

Accession A8MU10
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MGSIPSKPCNNPEGPLLQGMEAADWTGIGVCLPPGGARGHIYCCTRLCHQRAASAHRSLLLPRTVQTGGT      1 - 70
EREKPGPGQRKRGAHCSACKRSSTRPS                                                71 - 97
//

Text Mined References (2)

PMID Year Title
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.