Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.13
PubTator Score 0.08

Knowledge Summary


No data available


  Differential Expression (11)

Disease log2 FC p
Astrocytoma, Pilocytic -1.100 4.8e-03
chronic rhinosinusitis -2.202 3.2e-02
Endometriosis -1.301 1.9e-02
ependymoma 2.800 1.8e-07
glioblastoma -1.200 2.2e-02
group 4 medulloblastoma -1.300 2.2e-02
lung adenocarcinoma -1.200 4.9e-03
lung carcinoma -2.500 1.3e-05
medulloblastoma, large-cell -1.900 3.6e-03
nasopharyngeal carcinoma -2.600 2.3e-06
non-small cell lung carcinoma -1.400 4.3e-07

AA Sequence

LSLSESSTDEEEEDFLNKQHVITLPWSKST                                            771 - 800

Text Mined References (5)

PMID Year Title