Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.06
PubTator Score 0.08

Knowledge Summary


No data available


  Disease Sources (3)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 2.56751353592586E-11
lung adenocarcinoma 2714 6.52463732551953E-8
non-small cell lung carcinoma 413 4.29511878222094E-7
nasopharyngeal carcinoma 1056 2.33506635407727E-6
medulloblastoma 1524 6.52428504423828E-6
lung carcinoma 2844 1.34209593500551E-5
medulloblastoma, large-cell 6234 0.00361626742967768
pilocytic astrocytoma 3086 0.00476411022494706
Endometriosis 535 0.0188405264978712
glioblastoma 5572 0.021835373855685
chronic rhinosinusitis 512 0.0319566901632731
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Attention deficit hyperactivity disorder 156 3.2 1.6


  Differential Expression (11)

Disease log2 FC p
posterior fossa group B ependymoma 4.000 0.000
medulloblastoma -1.700 0.000
glioblastoma -1.200 0.022
medulloblastoma, large-cell -1.900 0.004
lung adenocarcinoma -1.900 0.000
pilocytic astrocytoma -1.100 0.005
nasopharyngeal carcinoma -2.600 0.000
Endometriosis -1.301 0.019
lung carcinoma -2.500 0.000
non-small cell lung carcinoma -1.400 0.000
chronic rhinosinusitis -2.202 0.032

AA Sequence

LSLSESSTDEEEEDFLNKQHVITLPWSKST                                            771 - 800

Text Mined References (5)

PMID Year Title
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.