Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.06
PubTator Score 0.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
posterior fossa group B ependymoma 4.000 0.000
medulloblastoma -1.700 0.000
glioblastoma -1.200 0.022
medulloblastoma, large-cell -1.900 0.004
lung adenocarcinoma -1.900 0.000
pilocytic astrocytoma -1.100 0.005
nasopharyngeal carcinoma -2.600 0.000
Endometriosis -1.301 0.019
lung carcinoma -2.500 0.000
non-small cell lung carcinoma -1.400 0.000
chronic rhinosinusitis -2.202 0.032

AA Sequence

MNRKDFVVLPWGKPGNSVKLKYRNAQELRMEKVQLEFENQEMEKKLQEFRSTRNKEKEDRESSEYYWKSG      1 - 70
KVGKLVNQSYMMSQNKGNVVKFSAGKVKLKLLKEQIQEPVKPTVNYKMANSSECEKPKINGKVCGQCENK     71 - 140
AALLVCLECGEDYCSGCFAKVHQKGALKLHRTTLLQAKSQILFNVLDVAHQFIKDVNPDEPKEENNSTKE    141 - 210
TSKIQHKPKSVLLQRSSSEVEITTMKRAQRTKPRKSLLCEGSFDEEASAQSFQEVLSQWRTGNHDDNKKQ    211 - 280
NLHAAVKDSLEECEVQTNLKIWREPLNIELKEDILSYMEKLWLKKHRRTPQEQLFKMLPDTFPHPHETTG    281 - 350
DAQCSQNENDEDSDGEETKVQHTALLLPVETLNIERPEPSLKIVELDDTYEEEFEEAENIVPYKVKLADA    351 - 420
DSQRSCAFHDCQKNSFPYENGIHQHHVFDKGKRDFLNLCLRNSSTYYKDNSKAETSNTDFDNIVDPDVYS    421 - 490
SDIEKIEESTSFERNLKEKNIGLESNQKSDDSCVSLESKDTLLGRDLEKAPIEEKLSQDIKESLELSNLY    491 - 560
KRPSFEESKTTKSSLLLQEIACRSKPITKQYQGLERFFIFDTNERLNLLPSHRLECNNSSTRITLAGQKS    561 - 630
QRPSTANFPLSNSVKESSSCLSSSHPRSRSAAAQSSSRAASEISEIEYIDITDQNELSLDDTTDQHTLDN    631 - 700
LEKELQVLRSLADTSEKLYSLTSEEFPDFSSQSLNISQISTDFLKTSHVRGPCGVEELSCSGRDTKIQSL    701 - 770
LSLSESSTDEEEEDFLNKQHVITLPWSKST                                            771 - 800
//

Text Mined References (5)

PMID Year Title
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.