Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession A8MPX8 Q96LI7
Symbols C3orf48

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (1)

AA Sequence

MSTNNALRVFWKSREWNMKTSTFDSDEDILLLPKRKRFRKKKSRPVRHTKRHEEEQVYEQGTTLPCSICK      1 - 70
HEIDLTGIFLHKKQHVALATLGFQWMGRKKPQPSVIAVQRQFMISKLLSSFMFTEKTLQSINNAFELLWK     71 - 140
KQIPAYYKIFDNIDRSVIYSQKICHLLIKGVGICEDRNSTWKADMNDKFTVVSNFGNKPNVCFFGLFDGH    141 - 210
HGASAAELTSMELPVLLLHQLSKFDPSYQMTTDEQQIINSFYTVFREEYAAIEDLFSAINKTEAVRCEYE    211 - 280
DTHKAFAKAFWRMDRLLGLGRKEVSRVQWSGCSAVTCILEGKPKSPYAHKNWKRKNTHDGLAESSPSQEM    281 - 350
PKIISGILHVANTGNVQAVLCRNGKGFCLTKEHTTRNTNERRRILQNGAVISSNEPYGLVEGQVKTTRGL    351 - 420
GFHGNLKLKKSIIPAPQTISVPIDDLCQFLIVATNGLWEVLDKEEVTALAMTTFHMYKETYCPIIPNKSP    421 - 490
SKGPLLFSTSEPNLTKSQSNIHVLFQYKSVSEVRVSTTNSKENLSDSNYSKYCIYNPENVETFPAETTHR    491 - 560
KPCSEKVTDRPTSVNDVATNEKESDTKSFYEGAAEYVSHELVNAALLAGSRDNITVMVIFLNGSEYQLLT    561 - 630
//

Text Mined References (4)

PMID Year Title
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.