Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.19
PubTator Score 2.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 4.7e-05
glioblastoma 1.300 1.1e-06
group 3 medulloblastoma 1.200 2.5e-03
hepatocellular carcinoma 1.200 1.4e-05
intraductal papillary-mucinous neoplasm ... 1.200 5.0e-03
malignant mesothelioma 1.400 2.2e-07
osteosarcoma -1.962 1.9e-03
ovarian cancer 2.000 1.9e-05
pancreatic cancer 1.200 3.2e-03
pancreatic carcinoma 1.200 3.2e-03
Pick disease -1.200 4.2e-04
primitive neuroectodermal tumor 1.400 1.6e-04
progressive supranuclear palsy -1.200 8.4e-03

Gene RIF (4)

AA Sequence

MATKRLARQLGLIRRKSIAPANGNLGRSKSKQLFDYLIVIDFESTCWNDGKHHHSQEIIEFPAVLLNTST      1 - 70
GQIDSEFQAYVQPQEHPILSEFCMELTGIKQAQVDEGVPLKICLSQFCKWIHKIQQQKNIIFATGISEPS     71 - 140
ASEVKLCAFVTWSDWDLGVCLEYECKRKQLLKPVFLNSWIDLRATYKLFYRRKPKGLSGALQEVGIEFSG    141 - 210
REHSGLDDSRNTALLAWKMIRDGCVMKITRSLNKVPTKKNFSILARNLNTIQVEEMSACNISIQGPSIYN    211 - 280
KEPKNIINPHEKVQMKSICANSPIKAQQDQLQVKNNIKASLHNVKSSLPLFNTKSSTSVGQLQSPTLNSP    281 - 350
IYMQKQGKNEHLAFNTKSKASTVGSELVLVSTTVPTVHHVSDLEMSSTLDCLPVLADWEDVVLLPASQPE    351 - 420
ENVDCTVPISDSDLEISFNSGERLMVLKELEMSSHENFGDIEETPQKSETSKSIVYKSPHTTIYNVKEAK    421 - 490
DPGSDISAFKLPEHKSSTFNRVNANMSHPLVLGKHPLLSGGTKRNPCSPQAFPPAKKQPFTIHEEKPTSS    491 - 560
DCSPVRSSSWRRLPSILTSTVNLQEPWKSGKMTPPLCKCGRRSKRLVVSNNGPNHGKVFYCCPIGKYQEN    561 - 630
RKCCGYFKWEQTLQKERANSMVPSHSTGGLTFSSPETSHICDRNLSISTKNSLRLRPSMRN             631 - 691
//

Text Mined References (9)

PMID Year Title