Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.19
PubTator Score 2.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
malignant mesothelioma 3163 2.22155469762617E-7
glioblastoma 5572 1.0622073085119E-6
hepatocellular carcinoma 550 1.35764627633404E-5
ovarian cancer 8492 1.85585120381594E-5
sonic hedgehog group medulloblastoma 1482 2.39896620198564E-5
atypical teratoid / rhabdoid tumor 4369 4.70105141304555E-5
primitive neuroectodermal tumor 3031 1.60058182174186E-4
Pick disease 1893 4.24414926914568E-4
osteosarcoma 7933 0.00189952291786295
pancreatic cancer 2300 0.00317525339155599
pancreatic carcinoma 567 0.003175253391556
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00504503496641093
progressive supranuclear palsy 674 0.00843804021875634

Expression

Synonym

Accession A8K979 Q6ZSJ2 Q96FR9 Q9P224 Q9Y6V3
Symbols EXOD1
ZGRF5

Gene

  Ortholog (8)

Species Source
Mouse OMA EggNOG Inparanoid
Rat EggNOG Inparanoid
Dog EggNOG Inparanoid
Cow EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus EggNOG Inparanoid
Anole lizard EggNOG Inparanoid
Xenopus EggNOG Inparanoid

Gene RIF (4)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18187620 Knockdown of ERI1 exoribonuclease family member 2 (ERI2) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17135487 This paper describes a detailed biochemical and genetic characterization of the exonuclease Snipper, the Drosophila ortholog of EXOD1. It identifies EXOD1 as a member of a new subclass of exonucleases called the 3'hExo/ERI-1 subfamily of DEDDh nucleases.

AA Sequence

MATKRLARQLGLIRRKSIAPANGNLGRSKSKQLFDYLIVIDFESTCWNDGKHHHSQEIIEFPAVLLNTST      1 - 70
GQIDSEFQAYVQPQEHPILSEFCMELTGIKQAQVDEGVPLKICLSQFCKWIHKIQQQKNIIFATGISEPS     71 - 140
ASEVKLCAFVTWSDWDLGVCLEYECKRKQLLKPVFLNSWIDLRATYKLFYRRKPKGLSGALQEVGIEFSG    141 - 210
REHSGLDDSRNTALLAWKMIRDGCVMKITRSLNKVPTKKNFSILARNLNTIQVEEMSACNISIQGPSIYN    211 - 280
KEPKNIINPHEKVQMKSICANSPIKAQQDQLQVKNNIKASLHNVKSSLPLFNTKSSTSVGQLQSPTLNSP    281 - 350
IYMQKQGKNEHLAFNTKSKASTVGSELVLVSTTVPTVHHVSDLEMSSTLDCLPVLADWEDVVLLPASQPE    351 - 420
ENVDCTVPISDSDLEISFNSGERLMVLKELEMSSHENFGDIEETPQKSETSKSIVYKSPHTTIYNVKEAK    421 - 490
DPGSDISAFKLPEHKSSTFNRVNANMSHPLVLGKHPLLSGGTKRNPCSPQAFPPAKKQPFTIHEEKPTSS    491 - 560
DCSPVRSSSWRRLPSILTSTVNLQEPWKSGKMTPPLCKCGRRSKRLVVSNNGPNHGKVFYCCPIGKYQEN    561 - 630
RKCCGYFKWEQTLQKERANSMVPSHSTGGLTFSSPETSHICDRNLSISTKNSLRLRPSMRN             631 - 691
//

Text Mined References (9)

PMID Year Title
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17135487 2006 Genetic and biochemical characterization of Drosophila Snipper: A promiscuous member of the metazoan 3'hExo/ERI-1 family of 3' to 5' exonucleases.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10819331 2000 Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
10493829 1999 Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q.