Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.20
PubTator Score 1.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -2.200 0.004
posterior fossa group A ependymoma -2.300 0.000
oligodendroglioma -1.900 0.010
glioblastoma -2.900 0.000
medulloblastoma -2.300 0.000
atypical teratoid / rhabdoid tumor -2.700 0.000
medulloblastoma, large-cell -3.100 0.000
primitive neuroectodermal tumor -1.900 0.001
adult high grade glioma -2.700 0.000
pilocytic astrocytoma -2.300 0.000
Pick disease -1.100 0.001

Synonym

Accession A6XGL0 A6XGK9 Q4G1C0 YjeF_N3
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MSSAAGPDPSEAPEERHFLRALELQPPLADMGRAELSSNATTSLVQRRKQAWGRQSWLEQIWNAGPVCQS      1 - 70
TAEAAALERELLEDYRFGRQQLVELCGHASAVAVTKAFPLPALSRKQRTVLVVCGPEQNGAVGLVCARHL     71 - 140
RVFEYEPTIFYPTRSLDLLHRDLTTQCEKMDIPFLSYLPTEVQLINEAYGLVVDAVLGPGVEPGEVGGPC    141 - 210
TRALATLKLLSIPLVSLDIPSGWDAETGSDSEDGLRPDVLVSLAAPKRCAGRFSGRHHFVAGRFVPDDVR    211 - 280
RKFALRLPGYTGTDCVAAL                                                       281 - 299
//

Text Mined References (6)

PMID Year Title
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
17533573 2007 ApoA-I-binding protein (AI-BP) and its homologues hYjeF_N2 and hYjeF_N3 comprise the YjeF_N domain protein family in humans with a role in spermiogenesis and oogenesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.