Property Summary

NCBI Gene PubMed Count 4
PubMed Score 2.00
PubTator Score 12.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 3.4e-09
posterior fossa group B ependymoma 416 3.3e-05

AA Sequence

MDIPISSRDFRGLQLACVALGLVAGSIIIGISVSKAAAAMGGVFIGAAVLGLLILAYPFLKARFNLDHIL      1 - 70
PTIGSLRIHPHPGADHGEGRSSTNGNKEGARSSLSTVSRTLEKLKPGTRGAEEC                     71 - 124
//

Text Mined References (5)

PMID Year Title