Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.88
PubTator Score 0.83

Knowledge Summary

Patent

No data available

Synonym

Accession A6PVC2 B5MDV0
Symbols

Gene

AA Sequence

MEPERKGLSLASSSDGDGREENKLKQGISQDLASSSRLDRYKIARQLTEKAIKEKKIFSIYGHYPVVRAA      1 - 70
LRRKGWVEKKFHFLPKVIPDVEDEGARVNDDTCAKVKENQEMALEKTDNIHDVMSRLVKNEMPYLLWTIK     71 - 140
RDIIDYHSLTYDQMLNHYAKTASFTTKIGLCVNMRSLPWYVPANPDSFFPRCYSLCTESEQQEFLEDFRR    141 - 210
TMASSILKWVVSHQSCSRSSRSKPRDQREEAGSSDLSSRQDAENAEAKLRGLPGQLVDIACKVCQAYLGQ    211 - 280
LEHEDIDTSADAVEDLTEAEWEDLTQQYYSLVHGDAFISNSRNYFSQCQALLNRITSVNPQTDIDGLRNI    281 - 350
WIIKPAAKSRGRDIVCMDRVEEILELAAADHPLSRDNKWVVQKYIETPLLICDTKFDIRQWFLVTDWNPL    351 - 420
TIWFYKESYLRFSTQRFSLDKLDSAIHLCNNAVQKYLKNDVGRSPLLPAHNMWTSTRFQEYLQRQGRGAV    421 - 490
WGSVIYPSMKKAIAHAMKVAQDHVEPRKNSFELYGADFVLGRDFRPWLIEINSSPTMHPSTPVTAQLCAQ    491 - 560
VQEDTIKVAVDRSCDIGNFELLWRQPVVEPPPFSGSDLCVAGVSVRRARRQVLPVCNLKASASLLDAQPL    561 - 630
KARGPSAMPDPAQGPPSPALQRDLGLKEEKGLPLALLAPLRGAAESGGAAQPTRTKAAGKVELPACPCRH    631 - 700
VDSQAPNTGVPVAQPAKSWDPNQLNAHPLEPVLRGLKTAEGALRPPPGGKGEGTVCSRLPHHGHHVAACQ    701 - 770
TTGTTWDGGPGVCFLRQLLASELPMGPGLPRDPRAPPCLVCRGLLPPAGPCKRCRSFCAAVLQGASFVRL    771 - 840
GGRSCSPRTP                                                                841 - 850
//

Text Mined References (3)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15890843 2005 Tubulin polyglutamylase enzymes are members of the TTL domain protein family.
10591208 1999 The DNA sequence of human chromosome 22.