Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00
PubTator Score 8.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.300 2.8e-03
astrocytic glioma -1.200 2.3e-02
atypical teratoid / rhabdoid tumor -1.100 3.9e-04
ependymoma -1.100 3.0e-02
glioblastoma -1.200 4.2e-04
lung carcinoma 2.200 5.9e-27
medulloblastoma, large-cell -1.600 1.7e-05
sonic hedgehog group medulloblastoma -1.200 4.4e-04

Gene RIF (2)

AA Sequence

MCKDYVYDKDIEQIAKEEQGEALKLQASTSTEVSHQQCSVPGLGEKFPTWETTKPELELLGHNPRRRRIT      1 - 70
SSFTIGLRGLINLGNTCFMNCIVQALTHTPILRDFFLSDRHRCEMPSPELCLVCEMSSLFRELYSGNPSP     71 - 140
HVPYKLLHLVWIHARHLAGYRQQDAHEFLIAALDVLHRHCKGDDVGKAANNPNHCNCIIDQIFTGGLQSD    141 - 210
VTCQACHGVSTTIDPCWDISLDLPGSCTSFWPMSPGRESSVNGESHIPGITTLTDCLRRFTRPEHLGSSA    211 - 280
KIKCGSCQSYQESTKQLTMNKLPVVACFHFKRFEHSAKQRRKITTYISFPLELDMTPFMASSKESRMNGQ    281 - 350
LQLPTNSGNNENKYSLFAVVNHQGTLESGHYTSFIRHHKDQWFKCDDAVITKASIKDVLDSEGYLLFYHK    351 - 420
QVLEHESEKVKEMNTQAY                                                        421 - 438
//

Text Mined References (7)

PMID Year Title