Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 8.01

Knowledge Summary

Patent

No data available

AA Sequence

MCKDYVYDKDIEQIAKEEQGEALKLQASTSTEVSHQQCSVPGLGEKFPTWETTKPELELLGHNPRRRRIT      1 - 70
SSFTIGLRGLINLGNTCFMNCIVQALTHTPILRDFFLSDRHRCEMPSPELCLVCEMSSLFRELYSGNPSP     71 - 140
HVPYKLLHLVWIHARHLAGYRQQDAHEFLIAALDVLHRHCKGDDVGKAANNPNHCNCIIDQIFTGGLQSD    141 - 210
VTCQACHGVSTTIDPCWDISLDLPGSCTSFWPMSPGRESSVNGESHIPGITTLTDCLRRFTRPEHLGSSA    211 - 280
KIKCGSCQSYQESTKQLTMNKLPVVACFHFKRFEHSAKQRRKITTYISFPLELDMTPFMASSKESRMNGQ    281 - 350
LQLPTNSGNNENKYSLFAVVNHQGTLESGHYTSFIRHHKDQWFKCDDAVITKASIKDVLDSEGYLLFYHK    351 - 420
QVLEHESEKVKEMNTQAY                                                        421 - 438
//

Text Mined References (5)

PMID Year Title
27013495 2016 The deubiquitinase Usp27x stabilizes the BH3-only protein Bim and enhances apoptosis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15772651 2005 The DNA sequence of the human X chromosome.
12838346 2003 Human and mouse proteases: a comparative genomic approach.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.