Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 1.3e-02

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.300 1.3e-02

AA Sequence

MQKHYTVAWFLYSAPGVDPSPPCRSLGWKRKKEWSDESEEEPEKELAPEPEETWVVEMLCGLKMKLKQQR      1 - 70
VSPILPEHHKDFNSQLAPGVDPSPPHRSFCWKRKREWWDESEESLEEEPRKVLAPEPEEIWVVEMLCGLK     71 - 140
MKLKRRRVSLVLPEHHEAFNRLLEDPVIKRFLAWDKDLRVSDKYLLAMVIAYFSRAGLPSWQYQRIHFFL    141 - 210
ALYLANDMEEDDEDPKQNIFYFLYGKTRSRIPLVRNRRFQLCRCMNPRARKNRSQIALFQKLRFQFFCSM    211 - 280
SGRAWVSREELEEIQAYDPEHWVWARDRARLS                                          281 - 312
//

Text Mined References (2)

PMID Year Title