Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.300 0.013

Synonym

Accession A6NNV3
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MQKHYTVAWFLYSAPGVDPSPPCRSLGWKRKKEWSDESEEEPEKELAPEPEETWVVEMLCGLKMKLKQQR      1 - 70
VSPILPEHHKDFNSQLAPGVDPSPPHRSFCWKRKREWWDESEESLEEEPRKVLAPEPEEIWVVEMLCGLK     71 - 140
MKLKRRRVSLVLPEHHEAFNRLLEDPVIKRFLAWDKDLRVSDKYLLAMVIAYFSRAGLPSWQYQRIHFFL    141 - 210
ALYLANDMEEDDEDPKQNIFYFLYGKTRSRIPLVRNRRFQLCRCMNPRARKNRSQIALFQKLRFQFFCSM    211 - 280
SGRAWVSREELEEIQAYDPEHWVWARDRARLS                                          281 - 312
//

Text Mined References (1)

PMID Year Title
12853948 2003 The DNA sequence of human chromosome 7.