Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
interstitial cystitis -1.600 3.7e-03
non primary Sjogren syndrome sicca -1.300 2.3e-02
sonic hedgehog group medulloblastoma 1.300 2.6e-03

 Compartment GO Term (0)

AA Sequence

MKEERNYNFDGVSTNRLKQQLLEEVRKKDAVQLSIFELRHKITELEAKLNTDNEGSEWKTRYETQLELND      1 - 70
ELEKQIVYLKEKVEKIHGNSSDRLSSIRVYERMPVESLNTLLKQLEEEKKTLESQVKYYALKLEQESKAY     71 - 140
QKINNERRTYLAEMSQGSGLHQVSKRQQVDQLPRMQENLVKTGRYNPAKQKTVSAKRGPVKKITRPNHLP    141 - 210
ELHP                                                                      211 - 214
//

Text Mined References (5)

PMID Year Title