Property Summary

NCBI Gene PubMed Count 6
PubMed Score 4.02
PubTator Score 5.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Foveal Hypoplasia and Anterior Segment Dysgenesis 1 0.0 0.0
Disease Target Count P-value
psoriasis 6694 5.9e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Achromatopsia 16 4.451 2.2
Aniridia 25 4.073 2.0
Congenital nystagmus 26 4.019 2.0
Disease Target Count
FOVEAL HYPOPLASIA 2 1

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.700 5.9e-05

Gene RIF (4)

AA Sequence

MEGQTPGSRGLPEKPHPATAAATLSSMGAVFILMKSALGAGLLNFPWAFSKAGGVVPAFLVELVSLVFLI      1 - 70
SGLVILGYAAAVSGQATYQGVVRGLCGPAIGKLCEACFLLNLLMISVAFLRVIGDQLEKLCDSLLSGTPP     71 - 140
APQPWYADQRFTLPLLSVLVILPLSAPREIAFQKYTSILGTLAACYLALVITVQYYLWPQGLVRESHPSL    141 - 210
SPASWTSVFSVFPTICFGFQCHEAAVSIYCSMRKRSLSHWALVSVLSLLACCLIYSLTGVYGFLTFGTEV    211 - 280
SADVLMSYPGNDMVIIVARVLFAVSIVTVYPIVLFLGRSVMQDFWRRSCLGGWGPSALADPSGLWVRMPL    281 - 350
TILWVTVTLAMALFMPDLSEIVSIIGGISSFFIFIFPGLCLICAMGVEPIGPRVKCCLEVWGVVSVLVGT    351 - 420
FIFGQSTAAAVWEMF                                                           421 - 435
//

Text Mined References (7)

PMID Year Title