Property Summary

NCBI Gene PubMed Count 2
PubMed Score 3.95
PubTator Score 2.50

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
Endometriosis -1.616 5.0e-02
lung adenocarcinoma -1.300 2.0e-03
lung carcinoma -2.500 1.4e-05
nasopharyngeal carcinoma -4.200 3.6e-07
non-small cell lung cancer -1.404 6.7e-04
posterior fossa group B ependymoma 1.900 7.0e-04
psoriasis -1.600 5.7e-03

Synonym

Accession A6NMZ2 B7FF65
Symbols S100AL
sentan
S100A1L

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MGGCMHSTQDKSLHLEGDPNPSAAPTSTCAPRKMPKRISISKQLASVKALRKCSDLEKAIATTALIFRNS      1 - 70
SDSDGKLEKAIAKDLLQTQFRNFAEGQETKPKYREILSELDEHTENKLDFEDFMILLLSITVMSDLLQNI     71 - 140
RNVKIMK                                                                   141 - 147
//

Text Mined References (3)

PMID Year Title