Property Summary

NCBI Gene PubMed Count 2
PubMed Score 4.20
PubTator Score 2.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
non-small cell lung cancer -1.404 0.001
lung adenocarcinoma -2.200 0.000
posterior fossa group B ependymoma 1.900 0.001
nasopharyngeal carcinoma -4.200 0.000
Endometriosis -1.616 0.050
lung carcinoma -2.500 0.000
psoriasis -1.600 0.006

Gene RIF (1)

PMID Text
18829862 Data suggest that sentan is the first molecular component of the ciliary tip to bridge the cell membrane and peripheral singlet microtubules, making the distal portion of the cilia narrow and stiff to allow for better airway clearance or ovum transport.

AA Sequence

MGGCMHSTQDKSLHLEGDPNPSAAPTSTCAPRKMPKRISISKQLASVKALRKCSDLEKAIATTALIFRNS      1 - 70
SDSDGKLEKAIAKDLLQTQFRNFAEGQETKPKYREILSELDEHTENKLDFEDFMILLLSITVMSDLLQNI     71 - 140
RNVKIMK                                                                   141 - 147
//

Text Mined References (3)

PMID Year Title
18829862 2008 Sentan: a novel specific component of the apical structure of vertebrate motile cilia.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15289893 2004 Transcriptional gene expression profile of human nasopharynx.