Property Summary

NCBI Gene PubMed Count 2
PubMed Score 4.20
PubTator Score 2.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung adenocarcinoma 2714 9.57063579662758E-9
nasopharyngeal carcinoma 1056 3.64699227178318E-7
lung carcinoma 2844 1.44407306395546E-5
non-small cell lung cancer 2798 6.718337543097E-4
posterior fossa group B ependymoma 1530 7.00239769652268E-4
psoriasis 6685 0.00567183562854205
Endometriosis 535 0.0495404512874501

Expression

  Differential Expression (7)

Disease log2 FC p
non-small cell lung cancer -1.404 0.001
lung adenocarcinoma -2.200 0.000
posterior fossa group B ependymoma 1.900 0.001
nasopharyngeal carcinoma -4.200 0.000
Endometriosis -1.616 0.050
lung carcinoma -2.500 0.000
psoriasis -1.600 0.006

Synonym

Accession A6NMZ2 B7FF65
Symbols S100AL
sentan
S100A1L

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
18829862 Data suggest that sentan is the first molecular component of the ciliary tip to bridge the cell membrane and peripheral singlet microtubules, making the distal portion of the cilia narrow and stiff to allow for better airway clearance or ovum transport.

AA Sequence

MGGCMHSTQDKSLHLEGDPNPSAAPTSTCAPRKMPKRISISKQLASVKALRKCSDLEKAIATTALIFRNS      1 - 70
SDSDGKLEKAIAKDLLQTQFRNFAEGQETKPKYREILSELDEHTENKLDFEDFMILLLSITVMSDLLQNI     71 - 140
RNVKIMK                                                                   141 - 147
//

Text Mined References (3)

PMID Year Title
18829862 2008 Sentan: a novel specific component of the apical structure of vertebrate motile cilia.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15289893 2004 Transcriptional gene expression profile of human nasopharynx.