Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.13
PubTator Score 0.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 2.6e-07
Disease Target Count Z-score Confidence
Cardiovascular system disease 246 0.0 0.7
Disease Target Count Z-score Confidence
Ataxia telangiectasia 34 3.045 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.400 2.6e-07

Gene RIF (1)

AA Sequence

MEQRNRLGALGYLPPLLLHALLLFVADAAFTEVPKDVTVREGDDIEMPCAFRASGATSYSLEIQWWYLKE      1 - 70
PPRELLHELALSVPGARSKVTNKDATKISTVRVQGNDISHRLRLSAVRLQDEGVYECRVSDYSDDDTQEH     71 - 140
KAQAMLRVLSRFAPPNMQAAEAVSHIQSSGPRRHGPASAANANNAGAASRTTSEPGRGDKSPPPGSPPAA    141 - 210
IDPAVPEAAAASAAHTPTTTVAAAAAASSASPPSGQAVLLRQRHGSGTGRSYTTDPLLSLLLLALHKFLR    211 - 280
LLLGH                                                                     281 - 285
//

Text Mined References (4)

PMID Year Title