Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.13
PubTator Score 0.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Ataxia telangiectasia 31 3.019 1.5
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.400 0.000

Gene RIF (1)

PMID Text
19240061 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEQRNRLGALGYLPPLLLHALLLFVADAAFTEVPKDVTVREGDDIEMPCAFRASGATSYSLEIQWWYLKE      1 - 70
PPRELLHELALSVPGARSKVTNKDATKISTVRVQGNDISHRLRLSAVRLQDEGVYECRVSDYSDDDTQEH     71 - 140
KAQAMLRVLSRFAPPNMQAAEAVSHIQSSGPRRHGPASAANANNAGAASRTTSEPGRGDKSPPPGSPPAA    141 - 210
IDPAVPEAAAASAAHTPTTTVAAAAAASSASPPSGQAVLLRQRHGSGTGRSYTTDPLLSLLLLALHKFLR    211 - 280
LLLGH                                                                     281 - 285
//

Text Mined References (4)

PMID Year Title
23568457 2013 Genetic variants associated with disordered eating.
21441570 2011 Genome-wide meta-analysis for severe diabetic retinopathy.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
15057824 2004 The DNA sequence and biology of human chromosome 19.