Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession A6NLI5
Symbols

Gene

  Ortholog (1)

Species Source Disease
Horse OMA Inparanoid

 GO Function (1)

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MDSDTLRVFQNELICCICVNYFIDPVTTDCVHSFCRPCLCLCSEEGRAPMRCPLCRKISEKPNFNTNVAL      1 - 70
KKLASLARQTRPQNINSSDNICVLHEETKELFCEADKRLLCGPCSESPEHMAHSHSPIGWAAEECREKLI     71 - 140
KEMDYLWKINQETQNNLNQETSKFCSLVEDKRNRIVYRYQKMHIFLDEEEQRHLQALEREAKELFQQLQD    141 - 210
SQVRMTQHLEGMKDMYRELWETYHMPDVELLQDVGNISASRTDLAQMPKPQPVNPELTSWCITGVLDMLN    211 - 280
NFRVDNALSTEMTPCYISLSEDVRRVIFGDDHRSAPMDPQGVESFAVWCAQAFTSGKHYWEVDVTHSSNW    281 - 350
ILGVCRDSRTADTNIVIDSDKTFFSISSKTSNHYSLSTNSPPLIQYVQRPLGWVGVFLDYDNGSVSFFDV    351 - 420
SKGSLIYGFPPSSFSSPLRPFFCFGCT                                               421 - 447
//

Text Mined References (1)

PMID Year Title