Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession A6NLI5
Symbols

Gene

 GO Function (1)

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MDSDTLRVFQNELICCICVNYFIDPVTTDCVHSFCRPCLCLCSEEGRAPMRCPLCRKISEKPNFNTNVAL      1 - 70
KKLASLARQTRPQNINSSDNICVLHEETKELFCEADKRLLCGPCSESPEHMAHSHSPIGWAAEECREKLI     71 - 140
KEMDYLWKINQETQNNLNQETSKFCSLVEDKRNRIVYRYQKMHIFLDEEEQRHLQALEREAKELFQQLQD    141 - 210
SQVRMTQHLEGMKDMYRELWETYHMPDVELLQDVGNISASRTDLAQMPKPQPVNPELTSWCITGVLDMLN    211 - 280
NFRVDNALSTEMTPCYISLSEDVRRVIFGDDHRSAPMDPQGVESFAVWCAQAFTSGKHYWEVDVTHSSNW    281 - 350
ILGVCRDSRTADTNIVIDSDKTFFSISSKTSNHYSLSTNSPPLIQYVQRPLGWVGVFLDYDNGSVSFFDV    351 - 420
SKGSLIYGFPPSSFSSPLRPFFCFGCT                                               421 - 447
//

Text Mined References (1)

PMID Year Title
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.