Property Summary

NCBI Gene PubMed Count 3
PubMed Score 165.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Brain Edema 50 4.322 2.2
Obesity 678 3.849 1.9
Nephrogenic Diabetes Insipidus 16 3.41 1.7

AA Sequence

MVQASGHRRSTRGSKMVSWSVIAKIQEICERKMAREFLAEFMSTYVMMVFGLGSVAHMLLNKTFGSYLGV      1 - 70
NLGFGFGVTMGVHMAGRTSGAHMNAAVSLTNCALGRVPWRKFPVYVLGQFLGSFLAAATIYSLFYTAILH     71 - 140
FSGGELMVTGPVATVGIFATYLPDHMTLWRGFLNEEWLTGMLQLCLFAIVDQENNPALPGTHALVIGILV    141 - 210
VIIRVYHGMNTGYAINPSRDLPPRIFTFIAGWGKLVFSDGENLWWVPVVAPLLGASLGGIIYLVFIGSTI    211 - 280
PREPLKLEDSVAYEDHGITVLPKMGSHEPMISPLTLISVSPANRSSVHPAPPLHESMALEHF            281 - 342
//

Text Mined References (4)

PMID Year Title