Property Summary

NCBI Gene PubMed Count 3
PubMed Score 153.64

Knowledge Summary

Patent

No data available

Synonym

Accession A6NL99
Symbols AQPap-3

Gene

PANTHER Protein Class (1)

AA Sequence

MVQASGHRRSTRGSKMVSWSVIAKIQEICERKMAREFLAEFMSTYVMMVFGLGSVAHMLLNKTFGSYLGV      1 - 70
NLGFGFGVTMGVHMAGRTSGAHMNAAVSLTNCALGRVPWRKFPVYVLGQFLGSFLAAATIYSLFYTAILH     71 - 140
FSGGELMVTGPVATVGIFATYLPDHMTLWRGFLNEEWLTGMLQLCLFAIVDQENNPALPGTHALVIGILV    141 - 210
VIIRVYHGMNTGYAINPSRDLPPRIFTFIAGWGKLVFSDGENLWWVPVVAPLLGASLGGIIYLVFIGSTI    211 - 280
PREPLKLEDSVAYEDHGITVLPKMGSHEPMISPLTLISVSPANRSSVHPAPPLHESMALEHF            281 - 342
//

Text Mined References (4)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11952783 2002 Human aquaporin adipose (AQPap) gene. Genomic structure, promoter analysis and functional mutation.