Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung adenocarcinoma 2716 6.5e-07
Disease Target Count Z-score Confidence
Heart disease 306 0.0 2.7

Expression

  Differential Expression (1)

Disease log2 FC p
lung adenocarcinoma -1.200 6.5e-07

Gene RIF (1)

AA Sequence

MAGHPKEKVIPDEVHQNQILRELYLKELRTQKLYTQYHVNPLRKIHTVTRKPMSWHDNLEEPADARFLNL      1 - 70
IHHAAQGPRKKYPETQTENQEVGWDLEPLINPERHDRRLNHFRVCSDITLYKAKTWGLGDDHHK           71 - 134
//

Text Mined References (2)

PMID Year Title