Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Heart disease 279 2.0
lung adenocarcinoma 2,713

Expression

  Differential Expression (1)

Disease log2 FC p
lung adenocarcinoma -1.200 0.000

Synonym

Accession A6NL82 B7ZBL8
Symbols

Gene

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
18854154 Knockdown of family with sequence similarity 183, member A (FAM183A) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence

MAGHPKEKVIPDEVHQNQILRELYLKELRTQKLYTQYHVNPLRKIHTVTRKPMSWHDNLEEPADARFLNL      1 - 70
IHHAAQGPRKKYPETQTENQEVGWDLEPLINPERHDRRLNHFRVCSDITLYKAKTWGLGDDHHK           71 - 134
//

Text Mined References (2)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
11181995 2001 The sequence of the human genome.