Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.300 0.000

Synonym

Accession A6NKP2
Symbols

Gene

PANTHER Protein Class (2)

AA Sequence

MKSNPPRSSLEACKAAGQAPQQKTQAKPTKAARQKVLVTGGGGYLGFSLGSHLAKSGTSVILLDRRRPQW      1 - 70
ELSPETKFIQADVRDEEALYRAFEGVDCVFHVASYGMSGAEKLQKEQIESINVGGTKLVIDVCVRRRVPR     71 - 140
LIYTSTVNVAFGGKPIEQGDEDSVPYFPLDEHVDHYSRTKAIADQLTLMANGMPLPGGGTLRTCVLRPPG    141 - 210
IYGPEEQRHLPRVAGHIKKRLFMFRFGDHKARMNWVHVHNLVQAHVLAAEALTTAKGYVASGQAYYINDG    211 - 280
ESVNLFEWMAPLFEKLGYSQPWIQVPTSWVYLTAAVMERLHLALRPICSLPPLLTRSEVRSVAVTHTFQI    281 - 350
AKARAQLGYAPDKFRFADAVELYVQSTTRRPRGSTARTLLRLLLRLLLFLGLLALALHFLGLQPLHAAVE    351 - 420
RL                                                                        421 - 422
//

Text Mined References (2)

PMID Year Title
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.