Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.69
PubTator Score 0.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Alexithymia 16 5.4 2.7

Expression

AA Sequence

MSEQGRETEEEEGGGGASDTAPMLPRGPPDHQASALTCPGWSGPPLLPGRLLAGLLLHLLLPAAAFLLVL      1 - 70
LPAAAVVYLGFLCHSRVHPAPGPRCRALFSDRGSAALIVFGLLSLPPLLVLASAVRARLARRLRPLLPPP     71 - 140
AGTPGPRRPPGRPDEDEQLCAWV                                                   141 - 163
//

Text Mined References (1)

PMID Year Title