Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00
PubTator Score 0.17

Knowledge Summary

Patent

No data available

AA Sequence

MAFTDLLDALGSMGRFQLNHTALLLLPCGLLACHNFLQNFTAAVPPHHCRGPANHTEASTNDSGAWLRAT      1 - 70
IPLDQLGAPEPCRRFTKPQWALLSPNSSIPGAATEGCKDGWVYNRSVFPSTIVMEWDLVCEARTLRDLAQ     71 - 140
SVYMAGVLVGAAVFGSLADRLGCKGPLVWSYLQLAASGAATAYFSSFSAYCVFRFLMGMTFSGIILNSVS    141 - 210
LVVEWMPTRGRTVAGILLGYSFTLGQLILAGVAYLIRPWRCLQFAISAPFLIFFLYSWWLPESSRWLLLH    211 - 280
GKSQLAVQNLQKVAAMNGRKEEGERLTKEVMSSYIQSEFASVCTSNSILDLFRTPAIRKVTCCLMVIWFS    281 - 350
NSVAYYGLAMDLQKFGLSLYLVQALFGIINTPAMLVATATMIYVGRRATVASFLILAGLMVIANMFVPEG    351 - 420
TQILCTAQAALGKGCLASSFICVYLFTGELYPTEIRQMGMGFASVHARLGGLTAPLVTTLGEYSTILPPV    421 - 490
SFGATAILAGLAVCVLTETRNMPLVETIAAMERRVKEGSSKKHVEEKSEEISLQQLRASPLKETI         491 - 555
//

Text Mined References (9)

PMID Year Title
17714910 2007 Identification of six putative human transporters with structural similarity to the drug transporter SLC22 family.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16478971 2006 Transport of estrone sulfate by the novel organic anion transporter Oat6 (Slc22a20).
16341674 2005 Transcriptome analysis of human gastric cancer.
15869325 2005 A scan for positively selected genes in the genomes of humans and chimpanzees.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15369770 2004 Identification of a novel murine organic anion transporter family member, OAT6, expressed in olfactory mucosa.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.