Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.77
PubTator Score 2.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Glycine encephalopathy 29 4.901 2.5
Lip cancer 2 4.794 2.4

Expression

Gene RIF (2)

AA Sequence

MRQPAVRLVRLGRVPYAELLGLQDRWLRRLQAEPGIEAPSGTEAGALLLCEPAGPVYTAGLRGGLTPEET      1 - 70
ARLRALGAEVRVTGRGGLATFHGPGQLLCHPVLDLRRLGLRLRMHVASLEACAVRLCELQGLQDARARPP     71 - 140
PYTGVWLDDRKICAIGVRCGRHITSHGLALNCSTDLTWFEHIVPCGLVGTGVTSLSKELQRHVTVEEVMP    141 - 210
PFLVAFKEIYKCTLISEDSPN                                                     211 - 231
//

Text Mined References (7)

PMID Year Title