Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.32
PubTator Score 2.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

Synonym

Accession A6NK58
Symbols

Gene

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MRQPAVRLVRLGRVPYAELLGLQDRWLRRLQAEPGIEAPSGTEAGALLLCEPAGPVYTAGLRGGLTPEET      1 - 70
ARLRALGAEVRVTGRGGLATFHGPGQLLCHPVLDLRRLGLRLRMHVASLEACAVRLCELQGLQDARARPP     71 - 140
PYTGVWLDDRKICAIGVRCGRHITSHGLALNCSTDLTWFEHIVPCGLVGTGVTSLSKELQRHVTVEEVMP    141 - 210
PFLVAFKEIYKCTLISEDSPN                                                     211 - 231
//

Text Mined References (5)

PMID Year Title
24777537 2014 Lipoic acid biosynthesis defects.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
11181995 2001 The sequence of the human genome.