Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MDWNWRILFLVVIAAGAQSQVQLVQSGAEVKKPGASVKVSCKASGYTITSYCMHWVHQVHAQGLEWMGLV      1 - 70
CPSDGSTSYAQKFQARVTITRDTSMSTAYMELSSLRSEDTAMYYCVRDTM                         71 - 120
//

Text Mined References (4)

PMID Year Title
20660349 2010 IgE transcripts in the circulation of allergic children reflect a classical antigen-driven B cell response and not a superantigen-like activation.
10830953 2000 The DNA sequence of human chromosome 21.
3123998 1988 A new human immunoglobulin VH family preferentially rearranged in immature B-cell tumours.
1404388 1992 The repertoire of human germline VH sequences reveals about fifty groups of VH segments with different hypervariable loops.