Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
osteosarcoma 7,933

Synonym

Accession A6NJI1
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MGTGLRSQSLREPRPSYGKLQEPWGRPQEGQLRRALSLRQGQEKSRSQGLERGTEGPDATAQERVPGSLG      1 - 70
DTEQLIQAQRRGSRWWLRRYQQVRRRWESFVAIFPSVTLSQPASP                              71 - 115
//

Text Mined References (3)

PMID Year Title
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.