Property Summary

NCBI Gene PubMed Count 4
PubMed Score 3.21
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Perinatal necrotizing enterocolitis 21 3.08 1.5

Expression

Gene RIF (1)

AA Sequence

MCSYYHMKKRSVSGCNITIFAVMFSHLSAGKSPCGNQANVLCISRLEFVQYQS                       1 - 53
//

Text Mined References (5)

PMID Year Title