Property Summary

NCBI Gene PubMed Count 4
Grant Count 9
R01 Count 7
Funding $390,861.41
PubMed Score 3.21
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Perinatal necrotizing enterocolitis 18 3.087 1.5

Expression

Gene RIF (1)

PMID Text
19201837 IgA-inducing protein stimulation drives the production of mu-alpha switch circles from IgM(+)IgD(+) naive human B cells, indicating its role as an IgA switch factor.

AA Sequence

MCSYYHMKKRSVSGCNITIFAVMFSHLSAGKSPCGNQANVLCISRLEFVQYQS                       1 - 53
//

Text Mined References (5)

PMID Year Title
21074276 2010 Regulation of IgA responses in cattle, humans and mice.
19201837 2009 Human IgA-inducing protein from dendritic cells induces IgA production by naive IgD+ B cells.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
12874223 2003 Identification and characterization of a novel regulatory factor: IgA-inducing protein.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.