Property Summary

NCBI Gene PubMed Count 4
PubMed Score 3.21
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count Z-score Confidence
Perinatal necrotizing enterocolitis 18 3.087 1.5

Expression

Synonym

Accession A6NJ69
Symbols C5orf53

Gene

  Ortholog (3)

Species Source
Chimp OMA EggNOG
Rat OMA EggNOG Inparanoid
Cow EggNOG Inparanoid

Gene RIF (1)

PMID Text
19201837 IgA-inducing protein stimulation drives the production of mu-alpha switch circles from IgM(+)IgD(+) naive human B cells, indicating its role as an IgA switch factor.

AA Sequence

MCSYYHMKKRSVSGCNITIFAVMFSHLSAGKSPCGNQANVLCISRLEFVQYQS                       1 - 53
//

Text Mined References (5)

PMID Year Title
21074276 2010 Regulation of IgA responses in cattle, humans and mice.
19201837 2009 Human IgA-inducing protein from dendritic cells induces IgA production by naive IgD+ B cells.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
12874223 2003 Identification and characterization of a novel regulatory factor: IgA-inducing protein.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.