Knowledge Summary

Patent

No data available

AA Sequence

MFCCLGYEWLSGGCKTWHSAWVINTLADHHHRGTDFGGSPWLRIIIAFPRSYKVVLTLWTVYLWLSFLKT      1 - 70
IFQSENGHDVSTDVQQRARRSNRRRQEGLRSICMHTKKRVSSFPGNKIGLKDVITLRRHVETKGRAKIRK     71 - 140
MKVTTKINHHDKINGKRKTAKKQKLSVKECEHAEKERQVSEAEENGKLDMKEIHTYMKMFQRAQELRRRA    141 - 210
EDYHKCKIPPSARKALCNWVRMAAAEHRHSSGLPYWPYLTAETLKNRMGHQPPPPTQQHSITDNSLSLKT    211 - 280
PPECLLTPLPPSADDNLKTPPECLLTPLPPSAPPSADDNLKTPPLATQEAEAEKPPKPKRWRAAEMESPP    281 - 350
EPKRRRAAEVESPPEPKRRRAAEVEPSSPEPKRRRLSKLRTGHCTQA                           351 - 397
//

Text Mined References (1)

PMID Year Title
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.