Property Summary

NCBI Gene PubMed Count 6
PubMed Score 6.33
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Retinitis pigmentosa 11 59 3.487 1.7
Dyslexia 43 3.315 1.7

Expression

Gene RIF (3)

AA Sequence

MESNLQGTFLLNNTPLAQFPEMKAPVCQYSVQNSFYKLSPPGLGPQLAAGTPHGITDILSRPVAAPNNSL      1 - 70
LSGYPHVAGFGGLSSQGVYYSPQVGNFSKAGNEYPTRTRNCWADTGQDWRGGRQCSNTPDPLSDSIHKKK     71 - 140
HTRPTFTGHQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKSALEPSSSTPRAP    141 - 210
GGAGAGAGGDRAPSENEDDEYNKPLDPDSDDEKIRLLLRKHRAAFSVLSLGAHSV                   211 - 265
//

Text Mined References (8)

PMID Year Title