Property Summary

NCBI Gene PubMed Count 4
Grant Count 1
Funding $14,298.5
PubMed Score 5.74
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Dyslexia 36 3.445 1.7

Expression

Gene RIF (2)

PMID Text
26743476 Suggest that NKX6.3 might function as a master regulator of gastric differentiation by affecting SOX2 and CDX2 expression and the NKX6.3 inactivation may result in intestinal metaplasia in gastric epithelial cells.
26314965 Data suggest that NK6 homeobox 3 (NKX6.3) may control the fate of gastric mucosal cells and function as a gastric tumor suppressor.

AA Sequence

MESNLQGTFLLNNTPLAQFPEMKAPVCQYSVQNSFYKLSPPGLGPQLAAGTPHGITDILSRPVAAPNNSL      1 - 70
LSGYPHVAGFGGLSSQGVYYSPQVGNFSKAGNEYPTRTRNCWADTGQDWRGGRQCSNTPDPLSDSIHKKK     71 - 140
HTRPTFTGHQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKSALEPSSSTPRAP    141 - 210
GGAGAGAGGDRAPSENEDDEYNKPLDPDSDDEKIRLLLRKHRAAFSVLSLGAHSV                   211 - 265
//

Text Mined References (6)

PMID Year Title
26743476 2016 Inactivation of NKX6.3 in the stomach leads to abnormal expression of CDX2 and SOX2 required for gastric-to-intestinal transdifferentiation.
26314965 2015 NKX6.3 controls gastric differentiation and tumorigenesis.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16326147 2006 Cloning and analysis of Nkx6.3 during CNS and gastrointestinal development.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.