Property Summary

NCBI Gene PubMed Count 1
PubMed Score 1.75

Knowledge Summary

Patent

No data available

AA Sequence

MQKHYTVAWFLYSAPGVDPSPPCRSLGWKRKREWSDESAEEPEKELAPEPEETWVVEMLCGLKMKLKQQR      1 - 70
VSPILPEHHKGFNSQLAPGVDPSPPHRSFCWKRKMEWWDESEESLEEEPRKVLAPEPEEIWVAEMLCGLK     71 - 140
MKLKRRRVSLVLPEHHEAFNRLLEDPVIKRFLAWDKDLRVSDKYLLAMVIAYFSRAGFPSWQYQRIHFFL    141 - 210
ALYLANDMEEDDEDSKQNIFHFLYGKNRSRIPLLRKRWFQLGRSMNPRARKNRSRIPLLRKRRFQLGRSM    211 - 280
NLRARKNRSQIVLFQKRRFQFFCSMSGRAWVSPEELEEIQAYDPEHWVWARDRARLS                 281 - 337
//

Text Mined References (1)

PMID Year Title
12853948 2003 The DNA sequence of human chromosome 7.