Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.22
PubTator Score 1.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Nephronophthisis 80 3.657 1.8
Ciliopathy 71 3.165 1.6

Expression

Gene RIF (2)

AA Sequence

MSGSNPKAAAAASAAGPGGLVAGKEEKKKAGGGVLNRLKARRQAPHHAADDGVGAAVTEQELLALDTIRP      1 - 70
EHVLRLSRVTENYLCKPEDNIYSIDFTRFKIRDLETGTVLFEIAKPCVSDQEEDEEEGGGDVDISAGRFV     71 - 140
RYQFTPAFLRLRTVGATVEFTVGDKPVSNFRMIERHYFREHLLKNFDFDFGFCIPSSRNTCEHIYEFPQL    141 - 210
SEDVIRLMIENPYETRSDSFYFVDNKLIMHNKADYAYNGGQ                                 211 - 251
//

Text Mined References (16)

PMID Year Title