Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession A6NIE6
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MAAPLLHTRLPGDAAASPSAVKMLGASRTGISNMRALENDFFNSPPRKTVQFGGTVTEVLLKYKTGETND      1 - 70
FELLKNQLLDPDIKDDQIINWLLEFRSSIMYLTKDFEQLISIILRLPWLNRSQTVVEEYLAFLGNLVSAQ     71 - 140
TVFLRPCLSMIASHFVPPRVIIKEGDVDVSDSDDEDDNLPANFDTSQSLANNSKICTIECYVHNLLRISV    141 - 210
YFPTLRHEILELIIEKLLKLDVNASRQGIEDAEETANQTCGGTDSTEGLCNMGFAEAFLEPLWKKLQDPS    211 - 280
NPAIIRQAAGNYIGSFLARAKFIPLMIREQRHSAMLLSMDHFTQPAKLCSTPLFLDTSSF              281 - 340
//

Text Mined References (3)

PMID Year Title
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.