Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.45
PubTator Score 0.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
acute myeloid leukemia 1.100 2.7e-02
acute quadriplegic myopathy -1.190 1.8e-03
atypical teratoid / rhabdoid tumor -1.400 3.5e-04
autosomal dominant Emery-Dreifuss muscul... -1.188 5.0e-03
breast carcinoma -1.200 8.3e-12
Chronic Lymphocytic Leukemia 1.216 2.2e-02
colon cancer -2.000 1.6e-07
ductal carcinoma in situ -2.200 4.3e-04
gastric carcinoma 1.300 4.3e-02
group 4 medulloblastoma -1.600 1.7e-04
intraductal papillary-mucinous adenoma (... -1.300 2.7e-02
intraductal papillary-mucinous carcinoma... -2.200 2.7e-04
intraductal papillary-mucinous neoplasm ... -1.900 7.6e-03
invasive ductal carcinoma -2.700 2.5e-03
lung adenocarcinoma -1.202 1.0e-05
lung cancer -2.000 7.2e-04
lung carcinoma -2.600 7.7e-41
malignant mesothelioma -1.900 3.2e-06
medulloblastoma, large-cell -1.900 5.5e-07
non-small cell lung cancer -1.866 4.3e-22
osteosarcoma -3.286 1.8e-04
ovarian cancer -1.200 2.8e-09
pancreatic cancer -1.100 1.2e-04
pancreatic ductal adenocarcinoma liver m... -1.579 6.6e-04
periodontitis 1.100 1.9e-23
pituitary cancer 1.900 4.8e-03
spina bifida -2.708 3.3e-02
ulcerative colitis 2.100 6.6e-06

Gene RIF (1)

AA Sequence

MGCRHSRLSSCKPPKKKRQEPEPEQPPRPEPHELGPLNGDTAITVQLCASEEAERHQKDITRILQQHEEE      1 - 70
KKKWAQQVEKERELELRDRLDEQQRVLEGKNEEALQVLRASYEQEKEALTHSFREASSTQQETIDRLTSQ     71 - 140
LEAFQAKMKRVEESILSRNYKKHIQDYGSPSQFWEQELESLHFVIEMKNERIHELDRRLILMETVKEKNL    141 - 210
ILEEKITTLQQENEDLHVRSRNQVVLSRQLSEDLLLTREALEKEVQLRRQLQQEKEELLYRVLGANASPA    211 - 280
FPLAPVTPTEVSFLAT                                                          281 - 296
//

Text Mined References (9)

PMID Year Title