Property Summary

NCBI Gene PubMed Count 8
PubMed Score 539.00

Knowledge Summary

Patent

No data available

Synonym

Accession A6NI72 NCF-1B
Symbols NCF-1B
SH3PXD1B

Gene

Gene RIF (2)

PMID Text
19077231 Observational study of gene-disease association. (HuGE Navigator)
16720733 IL-10 inhibits GM-CSF-induced priming of reactive oxygen species production by inhibiting p47PHOX phosphorylation.

AA Sequence

MGDTFIRHIALLGFEKRFVPSQHYVRYMFLVKWQDLSEKVVYRRFTEIYEFHKTLKEMFPIEAGAINPEN      1 - 70
RIIPHLPAPKWFDGQRAAENHQGTLTEYCGTLMSLPTKISRCPHLLDFFKVRPDDLKLPTDNQTKKPETY     71 - 140
LMPKDGKSTATDITGPIILQTYRAIANYEKTSGSEMALSTGDVVEVVEKSESGWWFCQMKAKRGWIPASF    141 - 210
LEPLDSPDETEDPEPNYAGEPYVAIKAYTAVEGDEVSLLEGEAVEVIHKLLDGWWVIRKDDVTGYFPSMY    211 - 280
LQKSGQDVSQAQRQIKRGAPPRRSSIRNVHSIHQRSRKRLSQDAYRRNSVRFLQQRRRQARPGPQSPGSP    281 - 350
LEEERQTQRSKPQPAVPPRPSADLILNRCSESTKRKLASAV                                 351 - 391
//

Text Mined References (8)

PMID Year Title
26086043 Functional pseudogenes inhibit the superoxide production.
19077231 2008 NCF1 gene and pseudogene pattern: association with parasitic infection and autoimmunity.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12176908 2002 Identification of a novel NCF-1 (p47-phox) pseudogene not containing the signature GT deletion: significance for A47 degrees chronic granulomatous disease carrier detection.
10772875 2000 Genomic structure of the human p47-phox (NCF1) gene.
9847074 1998 Toward a complete human genome sequence.
9329953 1997 A p47-phox pseudogene carries the most common mutation causing p47-phox- deficient chronic granulomatous disease.