Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent (37)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Schizophrenia 501

AA Sequence

MENRNNMTEFVLLGLTENPKMQKIIFVVFFVIYIITVVGYVLIVVTITASPSLGSPMYLSLAYLSFIDAC      1 - 70
YSSVNTPNLITHSLYGKKAILFNGCMTQVFGEHFFGGAEGILLTVMAYDHYVAICKPLHYMTIMNQCVCA     71 - 140
LLMGVVWMGGFLHATIQILFIFQLPFCGPNVIDHFMCDLNPLLNLACTDTHMLELFIAANSGFICLLNFA    141 - 210
LLLVSYVVILCSLRTHSLEARHKALSTCVSHITVVILFFVPCIFVYMRPAATLPIDKAVAIFYTMITPML    211 - 280
NPLIYTLKNAQMKNAIRKLCSRKDISGDK                                             281 - 309
//

Text Mined References (3)

PMID Year Title
24097068 2013 Discovery and refinement of loci associated with lipid levels.
21822266 2011 Exome sequencing supports a de novo mutational paradigm for schizophrenia.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.