Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.800 1.9e-06
group 3 medulloblastoma -1.600 2.1e-04
medulloblastoma, large-cell -1.600 1.4e-03
ovarian cancer -1.800 1.1e-08
pituitary cancer 1.400 5.9e-06

Synonym

Accession A6NH52 B2RUV4 B7ZW18
Symbols FAM18A
YDR084C

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MKQALVDDTEDVSLDFGNEEELAFRKAKIRHPLATFFHLFFRVSAIVTYVSCDWFSKSFVGCFVMVLLLL      1 - 70
SLDFWSVKNVTGRLLVGLRWWNQIDEDGKSHWIFEARKVSPNSIAATEAEARIFWLGLIICPMIWIVFFF     71 - 140
STLFSLKLKWLALVVAGISLQAANLYGYILCKMGGNSDIGKVTASFLSQTVFQTACPGDFQKPGLEGLEI    141 - 210
HQH                                                                       211 - 213
//

Text Mined References (6)

PMID Year Title