Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 1.104681546514E-8
atypical teratoid / rhabdoid tumor 4369 1.88959638437333E-6
pituitary cancer 1972 5.92503742840654E-6
group 3 medulloblastoma 2254 2.11858078693225E-4
medulloblastoma, large-cell 6234 0.00141442870635724

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma -1.600 0.000
atypical teratoid / rhabdoid tumor -1.800 0.000
medulloblastoma, large-cell -1.600 0.001
ovarian cancer -1.800 0.000
pituitary cancer 1.400 0.000

Synonym

Accession A6NH52 B2RUV4 B7ZW18
Symbols FAM18A
YDR084C

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG
Opossum OMA EggNOG
Chicken OMA EggNOG
Xenopus OMA EggNOG
C. elegans OMA Inparanoid

AA Sequence

MKQALVDDTEDVSLDFGNEEELAFRKAKIRHPLATFFHLFFRVSAIVTYVSCDWFSKSFVGCFVMVLLLL      1 - 70
SLDFWSVKNVTGRLLVGLRWWNQIDEDGKSHWIFEARKVSPNSIAATEAEARIFWLGLIICPMIWIVFFF     71 - 140
STLFSLKLKWLALVVAGISLQAANLYGYILCKMGGNSDIGKVTASFLSQTVFQTACPGDFQKPGLEGLEI    141 - 210
HQH                                                                       211 - 213
//

Text Mined References (6)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.