Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent (92)


Accession A6NH00
Symbols OR2T8P


  Ortholog (2)

Species Source
Chimp OMA EggNOG
Cow OMA Inparanoid

AA Sequence

PLLNPLIYSVKNSEVKGALTRCMGRCVALSRE                                          281 - 312

Text Mined References (2)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.