Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1598.61

Knowledge Summary

Patent

No data available

Synonym

Accession A6NGU5 GGT 3
Symbols GGT3

Gene

PANTHER Protein Class (2)

AA Sequence

MKKKLVVLGLLAVVLVLVIVGLCLWLPSASKEPDNHVYTRAAVAADAKQCLEIGRDTLRDGGSAVDAAIA      1 - 70
ALLCVGLMNAHSMGIGVGLFLTIYNSTTRKAEVINAREVAPRLAFASMFNSSEQSQKGGLSVAVPGEIRG     71 - 140
YELAHQRHGRLPWARLFQPSIQLARQGFPVGKGLAAVLENKRTVIEQQPVLCEVFCRDRKVLREGERLTL    141 - 210
PRLADTYEMLAIEGAQAFYNGSLMAQIVKDIQAAGGIVTAEDLNNYCAELIEHPLNISLGDAVLYMPSAR    211 - 280
LSGPVLALILNILKGYNFSRESVETPEQKGLTYHRIVEAFRFAYAKRTLLGDPKFVDVTEVVRNMTSEFF    281 - 350
AAQLRSQISDHTTHPISYYKPEFYTPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVCSPVSGILFNNM    351 - 420
DDFSSPSITNEFGAPPSPANFIQPGKQPLLSMCPTIMVGQDGQVRMVVGAAGGTQITTDTALAIIYNLWF    421 - 490
GYDVKRAVEEPRLHNKLLPNVTTVERNIDQAVTAALETRHHHTQIASTFIAVVQAIVRTAGGWAAASDSR    491 - 560
KGGEPAGY                                                                  561 - 568
//

Text Mined References (9)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
18357469 2008 The human gamma-glutamyltransferase gene family.
14715246 2004 siRNA knock-down of gamma-glutamyl transpeptidase does not affect hypoxic K+ channel inhibition.
14642999 2003 Assessment of copper status in epileptic patients treated with anticonvulsant drugs by measuring the specific oxidase activity of ceruloplasmin.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10591208 1999 The DNA sequence of human chromosome 22.
8104871 1993 Mapping of human gamma-glutamyl transpeptidase genes on chromosome 22 and other human autosomes.
2573352 1989 Different gamma-glutamyl transpeptidase mRNAs are expressed in human liver and kidney.