Property Summary

NCBI Gene PubMed Count 2
PubMed Score 14.20
PubTator Score 9.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 8.20040222090593E-28
posterior fossa group B ependymoma 1530 1.10067888414528E-10
group 3 medulloblastoma 2254 2.39316028276119E-4
adult high grade glioma 2148 0.0016843803239465
diabetes mellitus 1663 0.00272985541438982
Disease Target Count Z-score Confidence
Choreatic disease 27 4.653 2.3
Sleep disorder 4 4.211 2.1
Encephalitis 54 3.234 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
posterior fossa group B ependymoma -1.600 0.000
diabetes mellitus 1.400 0.003
adult high grade glioma -1.400 0.002
group 3 medulloblastoma -1.700 0.000
psoriasis 1.200 0.000

Synonym

Accession A6NGN9
Symbols

Gene

PANTHER Protein Class (1)

  Ortholog (8)

Species Source
Mouse OMA Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA Inparanoid
Opossum OMA Inparanoid
Anole lizard OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (1)

PMID Text
24703753 The target antigen of patients with rapid-eye-movement parasomnia who produce antibodies (mainly IgG4) against IgLON5 is a neuronal cell adhesion molecule that suggests a tauopathy

AA Sequence

MPPPAPGARLRLLAAAALAGLAVISRGLLSQSLEFNSPADNYTVCEGDNATLSCFIDEHVTRVAWLNRSN      1 - 70
ILYAGNDRWTSDPRVRLLINTPEEFSILITEVGLGDEGLYTCSFQTRHQPYTTQVYLIVHVPARIVNISS     71 - 140
PVTVNEGGNVNLLCLAVGRPEPTVTWRQLRDGFTSEGEILEISDIQRGQAGEYECVTHNGVNSAPDSRRV    141 - 210
LVTVNYPPTITDVTSARTALGRAALLRCEAMAVPPADFQWYKDDRLLSSGTAEGLKVQTERTRSMLLFAN    211 - 280
VSARHYGNYTCRAANRLGASSASMRLLRPGSLENSAPRPPGLLALLSALGWLWWRM                  281 - 336
//

Text Mined References (2)

PMID Year Title
24703753 2014 A novel non-rapid-eye movement and rapid-eye-movement parasomnia with sleep breathing disorder associated with antibodies to IgLON5: a case series, characterisation of the antigen, and post-mortem study.
15057824 2004 The DNA sequence and biology of human chromosome 19.