Property Summary

NCBI Gene PubMed Count 2
PubMed Score 23.05
PubTator Score 9.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
adult high grade glioma -1.400 1.7e-03
diabetes mellitus 1.400 2.7e-03
ependymoma -1.300 4.0e-07
group 3 medulloblastoma -1.700 2.4e-04
psoriasis 1.200 8.2e-28

Gene RIF (1)

AA Sequence

MPPPAPGARLRLLAAAALAGLAVISRGLLSQSLEFNSPADNYTVCEGDNATLSCFIDEHVTRVAWLNRSN      1 - 70
ILYAGNDRWTSDPRVRLLINTPEEFSILITEVGLGDEGLYTCSFQTRHQPYTTQVYLIVHVPARIVNISS     71 - 140
PVTVNEGGNVNLLCLAVGRPEPTVTWRQLRDGFTSEGEILEISDIQRGQAGEYECVTHNGVNSAPDSRRV    141 - 210
LVTVNYPPTITDVTSARTALGRAALLRCEAMAVPPADFQWYKDDRLLSSGTAEGLKVQTERTRSMLLFAN    211 - 280
VSARHYGNYTCRAANRLGASSASMRLLRPGSLENSAPRPPGLLALLSALGWLWWRM                  281 - 336
//

Text Mined References (2)

PMID Year Title