Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Osteoporosis 363 0.0 0.9

Expression

Gene RIF (1)

AA Sequence

MARFQRTKEREEDRCSLNIYYVRNTTQGTAPACVGKRMQPSPTGKGGKCCTVHGLTRKIHNVQPNLQSPI      1 - 70
LSAACVD                                                                    71 - 77
//

Text Mined References (3)

PMID Year Title