Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.33

Knowledge Summary

Patent

No data available

Synonym

Accession A6NGG3 A6NMF8
Symbols Em:AL513424.1

Gene

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
26857357 Case Report: Fusion of the HMGA2 and C9orf92 genes in myolipoma with t(9;12)(p22;q14).

AA Sequence

MARFQRTKEREEDRCSLNIYYVRNTTQGTAPACVGKRMQPSPTGKGGKCCTVHGLTRKIHNVQPNLQSPI      1 - 70
LSAACVD                                                                    71 - 77
//

Text Mined References (3)

PMID Year Title
26857357 2016 Fusion of the HMGA2 and C9orf92 genes in myolipoma with t(9;12)(p22;q14).
15164053 2004 DNA sequence and analysis of human chromosome 9.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.