Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.29
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

AA Sequence

MAPTGLLVAGASFLAFRGLHWGLRRLPTPESAARDRWQWWNLCVSLAHSLLSGTGALLGLSLYPQMAADP      1 - 70
IHGHPRWALVLVAVSVGYFLADGADLLWNQTLGKTWDLLCHHLVVVSCLSTAVLSGHYVGFSMVSLLLEL     71 - 140
NSACLHLRKLLLLSRQAPSLAFSVTSWASLATLALFRLVPLGWMSLWLFRQHHQVPLALVTLGGIGLVTV    141 - 210
GIMSIILGIRILVNDVLQSRPHPPSPGHEKTRGTRTRRDNGPVTSNSSTLSLKD                    211 - 264
//

Text Mined References (2)

PMID Year Title