Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.29
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MAPTGLLVAGASFLAFRGLHWGLRRLPTPESAARDRWQWWNLCVSLAHSLLSGTGALLGLSLYPQMAADP      1 - 70
IHGHPRWALVLVAVSVGYFLADGADLLWNQTLGKTWDLLCHHLVVVSCLSTAVLSGHYVGFSMVSLLLEL     71 - 140
NSACLHLRKLLLLSRQAPSLAFSVTSWASLATLALFRLVPLGWMSLWLFRQHHQVPLALVTLGGIGLVTV    141 - 210
GIMSIILGIRILVNDVLQSRPHPPSPGHEKTRGTRTRRDNGPVTSNSSTLSLKD                    211 - 264
//

Text Mined References (2)

PMID Year Title
16793762 2006 When do Lasses (longevity assurance genes) become CerS (ceramide synthases)?: Insights into the regulation of ceramide synthesis.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.