Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.29
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Synonym

Accession A6NGC4
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MAPTGLLVAGASFLAFRGLHWGLRRLPTPESAARDRWQWWNLCVSLAHSLLSGTGALLGLSLYPQMAADP      1 - 70
IHGHPRWALVLVAVSVGYFLADGADLLWNQTLGKTWDLLCHHLVVVSCLSTAVLSGHYVGFSMVSLLLEL     71 - 140
NSACLHLRKLLLLSRQAPSLAFSVTSWASLATLALFRLVPLGWMSLWLFRQHHQVPLALVTLGGIGLVTV    141 - 210
GIMSIILGIRILVNDVLQSRPHPPSPGHEKTRGTRTRRDNGPVTSNSSTLSLKD                    211 - 264
//

Text Mined References (2)

PMID Year Title