Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.29
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 3.77493861436976E-8
nasopharyngeal carcinoma 1056 1.79661667128252E-6
posterior fossa group A ependymoma 1511 1.95136878777409E-5
cystic fibrosis 1670 1.42104673905943E-4
medulloblastoma, large-cell 6234 5.77556628370902E-4
osteosarcoma 7933 0.00261727802394089
breast carcinoma 1614 0.00322200459899664
pituitary cancer 1972 0.00391674887561115
invasive ductal carcinoma 2950 0.00392334614904935
atypical teratoid/rhabdoid tumor 1095 0.00495840188711098
ductal carcinoma in situ 1745 0.00531341551692123
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00563400890311512
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0103978352034052
adrenocortical carcinoma 1427 0.0151833577056238
subependymal giant cell astrocytoma 2287 0.0206293382545079
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0279156359701549

Expression

Synonym

Accession A6NGC4
Symbols

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

AA Sequence

MAPTGLLVAGASFLAFRGLHWGLRRLPTPESAARDRWQWWNLCVSLAHSLLSGTGALLGLSLYPQMAADP      1 - 70
IHGHPRWALVLVAVSVGYFLADGADLLWNQTLGKTWDLLCHHLVVVSCLSTAVLSGHYVGFSMVSLLLEL     71 - 140
NSACLHLRKLLLLSRQAPSLAFSVTSWASLATLALFRLVPLGWMSLWLFRQHHQVPLALVTLGGIGLVTV    141 - 210
GIMSIILGIRILVNDVLQSRPHPPSPGHEKTRGTRTRRDNGPVTSNSSTLSLKD                    211 - 264
//

Text Mined References (2)

PMID Year Title
16793762 2006 When do Lasses (longevity assurance genes) become CerS (ceramide synthases)?: Insights into the regulation of ceramide synthesis.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.