Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 7.31294739437683E-5

Expression

  Differential Expression (1)

Disease log2 FC p
posterior fossa group B ependymoma 1.400 0.000

Synonym

Accession A6NFN9 B4E2N8
Symbols C3orf16

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

 Compartment GO Term (1)

AA Sequence

MRIFIAFEGSFEPFDVSADETVEVVKLMIKDYFHIPLSEDKQGRRYLELMYAGAALKDSWSLADVGISFC      1 - 70
STLKCFVKEEDKPTLYVFNAVTQDTMPVMESISLLDKTVSDLRTLVTLRCGLPVSVYCLRTPRGLEMYDC     71 - 140
NTLKDYQTDIGTTLRLDVWDGWKEFLMGCLLGQKLKVQRYLSKEGPVLKYQKRVALYIAAFCGYIELTEW    141 - 210
ALKQGARPHEAVGVHPYRAWCHEALHADVSKCPIHAAAEAGQLLILKAFVNYSVLCLECKNAAGQTPLTI    211 - 280
VFKHKHKDCVLYLLSKMWSTVSFPKISVPMRIYIKIKQWILRAQSHSLHKSQFCGARVFGAKVGDTVMVD    281 - 350
GFTKPKMTSKSWHKAGNSDSQSIVLKLPSLSKQTASSKPVNPLAISQPDTRKQALKFHPLKGESPKADKS    351 - 420
SGIM                                                                      421 - 424
//

Text Mined References (4)

PMID Year Title
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.