Property Summary

NCBI Gene PubMed Count 1
PubMed Score 6.00
PubTator Score 2.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 3.7e-29

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.500 3.7e-29

AA Sequence

MALTPTNLNNKMSLQMKMDCQEQQLTKKNNGFFQKLNVTEGAMQDLLKEIIKVDHILDRSDDEDDISSEN      1 - 70
PQTDFLHKGMLELEAEHDQDLSKQDKQETDVDEDPQASTSLQFSKKNLLELCLKGMFLKLNYWNTKIGLQ     71 - 140
VKELGADYIDGTEKIDNIIKKINVTENTVKSLLKDMLTLKGQIEKLEDRGLDLDQGTSTEVNTCNEVYEL    141 - 210
KKKVIERLEDLCKNVELLSAKLRMYQMEAEDTDSHSSEEIDTEEMEALLPQAPASFLVQKSPPRNTAWKR    211 - 280
ALRIFIMFDVLTVTGLLCYILFFGATFLFERVLLRMLGCRTTWDLREMREPFLNLEVEALLPS           281 - 343
//

Text Mined References (1)

PMID Year Title