Property Summary

NCBI Gene PubMed Count 9
PubMed Score 26.43
PubTator Score 20.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 2.8e-26
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Hypereosinophilic syndrome 71 3.336 1.7

Gene RIF (2)

AA Sequence

MSDKLKERKRTPVSHKVIEKRRRDRINRCLNELGKTVPMALAKQSSGKLEKAEILEMTVQYLRALHSADF      1 - 70
PRGREKAELLAEFANYFHYGYHECMKNLVHYLTTVERMETKDTKYARILAFLQSKARLGAEPAFPPLGSL     71 - 140
PEPDFSYQLHPAGPEFAGHSPGEAAVFPQGSGAGPFPWPPGAARSPALPYLPSAPVPLASPAQQHSPFLT    141 - 210
PVQGLDRHYLNLIGHAHPNALNLHTPQHPPVL                                          211 - 242
//

Text Mined References (9)

PMID Year Title