Property Summary

NCBI Gene PubMed Count 9
Grant Count 7
R01 Count 7
Funding $432,339.75
PubMed Score 23.62
PubTator Score 20.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Gene RIF (2)

PMID Text
26582913 Activation of DPF3a upon hypertrophic stimuli in cardiac hypertrophy switches cardiac fetal gene expression from being silenced by HEY to being activated by BRG1.
15375612 identified and characterized human HES-like (HESL), rat hesl, and rainbow trout hesl genes by using bioinformatics

AA Sequence

MSDKLKERKRTPVSHKVIEKRRRDRINRCLNELGKTVPMALAKQSSGKLEKAEILEMTVQYLRALHSADF      1 - 70
PRGREKAELLAEFANYFHYGYHECMKNLVHYLTTVERMETKDTKYARILAFLQSKARLGAEPAFPPLGSL     71 - 140
PEPDFSYQLHPAGPEFAGHSPGEAAVFPQGSGAGPFPWPPGAARSPALPYLPSAPVPLASPAQQHSPFLT    141 - 210
PVQGLDRHYLNLIGHAHPNALNLHTPQHPPVL                                          211 - 242
//

Text Mined References (9)

PMID Year Title
26582913 2016 Phosphorylation of the chromatin remodeling factor DPF3a induces cardiac hypertrophy through releasing HEY repressors from DNA.
17611227 2007 Helt determines GABAergic over glutamatergic neuronal fate by repressing Ngn genes in the developing mesencephalon.
16644143 2006 Molecular characterization, structure and developmental expression of Megane bHLH factor.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15375612 2004 Identification and characterization of human HESL, rat Hesl and rainbow trout hesl genes in silico.
15071116 2004 Identification of a novel basic helix-loop-helix gene, Heslike, and its role in GABAergic neurogenesis.
14764602 2004 Helt, a novel basic-helix-loop-helix transcriptional repressor expressed in the developing central nervous system.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.