Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MGKDNASYLQAFILVGSSDRPGLEKILFAVILIFCILTLVGNTAIILLLVMDVRLHTPMYFFLGNLSFLD      1 - 70
LCFTASIAPQLLWNLGGPEKTITYHGCVAQLYIYMMLGSTECVLLVVMSHDRYVAVCRSLHYMAVMRPHL     71 - 140
CLQLVTVAWCCGFLNSFIMCPQTMQLSRCGRRRVDHFLCEMPALIAMSCEETMLVEAIHLCPGGGSPPGA    141 - 210
ALPHPHLLWRDCSRGAEDEVSSRAKESLPHLLFSPHSGLSLLRNHHLRVPEAGQQLLPRSGEVPDSLLHH    211 - 280
RHSQHQPPHLHFEEQGCEGDHEETSGVGERGWGASTRGTL                                  281 - 320
//

Text Mined References (4)

PMID Year Title