Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Breast cancer 3578 0.0 1.0

Synonym

Accession A6NF36
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Process (1)

 Compartment GO Term (1)

AA Sequence

MEPLYQAGSILMTVNTLQGKKMIESGLQSGDFSLSQSWPSCLPPPADLEILQQKVAGVQRELEDFKKEAL      1 - 70
KSIHYLEDAFCEMNGALVQQEEQAARVRQRLREEEDRGIVRNKVLTFLLPREKQLREHCKRLEDLLLDRG     71 - 140
RDALRATKKSQAD                                                             141 - 153
//

Text Mined References (3)

PMID Year Title