Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Skin disease 65 2.0

Synonym

Accession A6NEV1
Symbols

Gene

 Compartment GO Term (1)

AA Sequence

MGSRPRSPSAFPAPWWGQQPGGPGPAKRLRLEEPAGPEPRVAPSLEDPAGTPAVGALTSIVVLAAGCALR      1 - 70
VPLDDVDLVLELPPTSILRVSLDGHTLILIPEVLLSSVDERSGAQDDSSAGLEVDVFLGALREDVVVEQE     71 - 140
VFCASVPEIAAQEEAYEEDADPEFPELQMDSAAGSAAGLYSSARSMFSPYREGPIPEPCALAPNPSSEGH    141 - 210
SPGPFFDPEFRLLEPVPSSPLQPLPPSPRVGSPGPHAHPPLPKRPPCKARRRLFQE                  211 - 266
//

Text Mined References (1)

PMID Year Title
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.