Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count Z-score Confidence
Skin disease 65 0.0 2.0

Synonym

Accession A6NEV1
Symbols

Gene

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG
Rat OMA EggNOG
Cow OMA Inparanoid
Cow OMA EggNOG

 Compartment GO Term (1)

AA Sequence

MGSRPRSPSAFPAPWWGQQPGGPGPAKRLRLEEPAGPEPRVAPSLEDPAGTPAVGALTSIVVLAAGCALR      1 - 70
VPLDDVDLVLELPPTSILRVSLDGHTLILIPEVLLSSVDERSGAQDDSSAGLEVDVFLGALREDVVVEQE     71 - 140
VFCASVPEIAAQEEAYEEDADPEFPELQMDSAAGSAAGLYSSARSMFSPYREGPIPEPCALAPNPSSEGH    141 - 210
SPGPFFDPEFRLLEPVPSSPLQPLPPSPRVGSPGPHAHPPLPKRPPCKARRRLFQE                  211 - 266
//

Text Mined References (1)

PMID Year Title
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.